SCOPe 2.08: Domain d2b9py1: 2b9p Y:1-113

Lineage for d2b9py1 (2b9p Y:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries)
   Uniprot Q72I15 2-102

8. Domain d2b9py1: 2b9p Y:1-113 [128198]
   Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9pz1
   protein/RNA complex
   protein/RNA complex

Details for d2b9py1

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (Y:) 50S ribosomal protein 24

SCOPe Domain Sequences for d2b9py1:

Sequence, based on SEQRES records:

>d2b9py1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Sequence, based on observed residues (ATOM records):

>d2b9py1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Timeline for d2b9py1:

• d2b9py1 first appeared in SCOP 1.73
  
• d2b9py1 appears in SCOPe 2.07