![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) ![]() automatically mapped to Pfam PF00453 |
![]() | Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
![]() | Protein Ribosomal protein L20 [74733] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries) Uniprot P60491 1-117 |
![]() | Domain d2b9pu1: 2b9p U:2-118 [144982] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9pu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9pu1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
Timeline for d2b9pu1: