SCOPe 2.08: Domain d2b9px1: 2b9p X:1-78

Lineage for d2b9px1 (2b9p X:1-78)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)

8. Domain d2b9px1: 2b9p X:1-78 [128197]
   Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9py1, d2b9pz1
   protein/RNA complex
   protein/RNA complex

Details for d2b9px1

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (X:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2b9px1:

Sequence, based on SEQRES records:

>d2b9px1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

Sequence, based on observed residues (ATOM records):

>d2b9px1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
kkavvrlsedddqeva

Timeline for d2b9px1:

• d2b9px1 first appeared in SCOP 1.73
  
• d2b9px1 appears in SCOPe 2.07