SCOPe 2.08: Domain d2b9pt1: 2b9p T:4-56

Lineage for d2b9pt1 (2b9p T:4-56)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
   automatically mapped to Pfam PF01246

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
   Uniprot P14116

8. Domain d2b9pt1: 2b9p T:4-56 [128195]
   Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
   protein/RNA complex
   protein/RNA complex

Details for d2b9pt1

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (T:) 50S ribosomal protein L19

SCOPe Domain Sequences for d2b9pt1:

Sequence, based on SEQRES records:

>d2b9pt1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Sequence, based on observed residues (ATOM records):

>d2b9pt1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar

Timeline for d2b9pt1:

• d2b9pt1 first appeared in SCOP 1.73
  
• d2b9pt1 appears in SCOPe 2.07