Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.301: L35p-like [143033] (1 superfamily) core: alpha-beta(3)-alpha; 2layers a/b |
Superfamily d.301.1: L35p-like [143034] (1 family) automatically mapped to Pfam PF01632 |
Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein) Pfam PF01632 |
Protein Ribosomal protein L35p [143036] (3 species) |
Species Thermus thermophilus [TaxId:274] [160057] (9 PDB entries) Uniprot P80341 1-64 |
Domain d2b9p81: 2b9p 8:2-64 [144980] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9p81:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9p81 d.301.1.1 (8:2-64) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]} pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm lpr
Timeline for d2b9p81: