SCOPe 2.08: Domain d2b9pk2: 2b9p K:8-70

Lineage for d2b9pk2 (2b9p K:8-70)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
   Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70

8. Domain d2b9pk2: 2b9p K:8-70 [128191]
   Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
   protein/RNA complex
   protein/RNA complex

Details for d2b9pk2

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (K:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2b9pk2:

Sequence; same for both SEQRES and ATOM records:

>d2b9pk2 d.47.1.1 (K:8-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

Timeline for d2b9pk2:

• d2b9pk2 first appeared in SCOP 1.73
  
• d2b9pk2 appears in SCOPe 2.07