Lineage for d2b9p31 (2b9p 3:1-60)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956419Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2956420Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2956421Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 2956464Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 2956502Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 2956514Domain d2b9p31: 2b9p 3:1-60 [128184]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9p31

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (3:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2b9p31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9p31 d.59.1.1 (3:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d2b9p31:

Click to download the PDB-style file with coordinates for d2b9p31.
(The format of our PDB-style files is described here.)

Timeline for d2b9p31: