![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
![]() | Protein Ribosomal protein L32p [144201] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries) Uniprot P80339 1-59 |
![]() | Domain d2b9p51: 2b9p 5:2-59 [144978] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9p51:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9p51 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
Timeline for d2b9p51: