![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries) |
![]() | Domain d1j8hd2: 1j8h D:118-203 [71607] Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1 complexed with nag missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1j8h (more details), 2.4 Å
SCOPe Domain Sequences for d1j8hd2:
Sequence, based on SEQRES records: (download)
>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtf
>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava wsnksdfacanafnnsiipedtf
Timeline for d1j8hd2: