SCOPe 2.07: Domain d1j8hd2: 1j8h D:118-203

Lineage for d1j8hd2 (1j8h D:118-203)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d1j8hd2: 1j8h D:118-203 [71607]
   Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1
   complexed with nag, ndg

Details for d1j8hd2

PDB Entry: 1j8h, 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1j8hd2:

Sequence, based on SEQRES records:

>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records):

>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtf

Timeline for d1j8hd2:

• d1j8hd2 first appeared in SCOP 1.61
  
• d1j8hd2 appears in SCOPe 2.06
  
• d1j8hd2 appears in the current release, SCOPe 2.08