Lineage for d1j8hb2 (1j8h B:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938433Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)
  8. 2938440Domain d1j8hb2: 1j8h B:3-92 [71605]
    Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1j8hb2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-4 beta chain

SCOPe Domain Sequences for d1j8hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8hb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1j8hb2:

Click to download the PDB-style file with coordinates for d1j8hb2.
(The format of our PDB-style files is described here.)

Timeline for d1j8hb2: