![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries) |
![]() | Domain d1j8hd1: 1j8h D:1-117 [71606] Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd2, d1j8he2 complexed with nag |
PDB Entry: 1j8h (more details), 2.4 Å
SCOPe Domain Sequences for d1j8hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn
Timeline for d1j8hd1: