![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() |
![]() | Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
![]() | Protein automated matches [191003] (2 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries) |
![]() | Domain d3bz2l_: 3bz2 L: [172959] Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_ automated match to d2axtl1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d3bz2l_: