SCOPe 2.08: Domain d3bz2l_: 3bz2 L:

Lineage for d3bz2l_ (3bz2 L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein automated matches [191003] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries)

8. Domain d3bz2l_: 3bz2 L: [172959]
   Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2l_

PDB Entry: 3bz2, 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3bz2l_:

Sequence; same for both SEQRES and ATOM records:

>d3bz2l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d3bz2l_:

• d3bz2l_ first appeared in SCOPe 2.01
  
• d3bz2l_ appears in SCOPe 2.07