Lineage for d3bz2d_ (3bz2 D:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060394Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1060395Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1060396Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1060540Protein automated matches [190224] (5 species)
    not a true protein
  7. 1060615Species Thermosynechococcus elongatus [TaxId:32046] [188744] (2 PDB entries)
  8. 1060617Domain d3bz2d_: 3bz2 D: [172954]
    Other proteins in same PDB: d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_
    automated match to d2axtd1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2d_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (D:) Photosystem II reaction center D2 protein

SCOPe Domain Sequences for d3bz2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2d_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d3bz2d_:

Click to download the PDB-style file with coordinates for d3bz2d_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2d_: