![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
![]() | Protein automated matches [191004] (1 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:32046] [188749] (2 PDB entries) |
![]() | Domain d3bz2o_: 3bz2 O: [172961] Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2u_, d3bz2v_ automated match to d2axto1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi epa
Timeline for d3bz2o_: