Lineage for d3bz2l_ (3bz2 L:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238771Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
  5. 1238772Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 1238778Protein automated matches [191003] (2 species)
    not a true protein
  7. 1238779Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries)
  8. 1238780Domain d3bz2l_: 3bz2 L: [172959]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2k_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2z_
    automated match to d2axtl1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2l_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3bz2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d3bz2l_:

Click to download the PDB-style file with coordinates for d3bz2l_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2l_: