SCOPe 2.01: Domain d3bz2f_: 3bz2 F:

Lineage for d3bz2f_ (3bz2 F:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:32046] [188745] (2 PDB entries)

8. Domain d3bz2f_: 3bz2 F: [172956]
   Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_
   automated match to d2axtf1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2f_

PDB Entry: 3bz2, 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d3bz2f_:

Sequence; same for both SEQRES and ATOM records:

>d3bz2f_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
vsypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d3bz2f_:

• d3bz2f_ is new in SCOPe 2.01-stable
  
• d3bz2f_ appears in SCOPe 2.02
  
• d3bz2f_ appears in the current release, SCOPe 2.08