![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() |
![]() | Family f.23.35.1: PsbM-like [161034] (1 protein) Pfam PF05151 |
![]() | Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161036] (3 PDB entries) Uniprot Q8DHA7 1-36 |
![]() | Domain d3bz2m_: 3bz2 M: [172960] Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2o_, d3bz2u_, d3bz2v_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2m_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]} mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d3bz2m_: