Lineage for d3bz2m_ (3bz2 M:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060197Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
  5. 1060198Family f.23.35.1: PsbM-like [161034] (1 protein)
    Pfam PF05151
  6. 1060199Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 1060200Species Thermosynechococcus elongatus [TaxId:146786] [161036] (3 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 1060202Domain d3bz2m_: 3bz2 M: [172960]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2o_, d3bz2u_, d3bz2v_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2m_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d3bz2m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2m_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d3bz2m_:

Click to download the PDB-style file with coordinates for d3bz2m_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2m_: