Lineage for d3bz2h_ (3bz2 H:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060181Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
  5. 1060182Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 1060186Protein automated matches [191001] (2 species)
    not a true protein
  7. 1060187Species Thermosynechococcus elongatus [TaxId:32046] [188746] (2 PDB entries)
  8. 1060188Domain d3bz2h_: 3bz2 H: [172957]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_
    automated match to d2axth1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2h_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d3bz2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d3bz2h_:

Click to download the PDB-style file with coordinates for d3bz2h_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2h_: