Lineage for d3bz2v_ (3bz2 V:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 905032Protein automated matches [190113] (11 species)
    not a true protein
  7. 905064Species Thermosynechococcus elongatus [TaxId:32046] [188751] (2 PDB entries)
  8. 905065Domain d3bz2v_: 3bz2 V: [172963]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_
    automated match to d1mz4a_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2v_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d3bz2v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2v_ a.3.1.1 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d3bz2v_:

Click to download the PDB-style file with coordinates for d3bz2v_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2v_: