SCOPe 2.08: Domain d5zznb_: 5zzn B:

Lineage for d5zznb_ (5zzn B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)

8. Domain d5zznb_: 5zzn B: [375270]
   Other proteins in same PDB: d5zzna_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
   automated match to d4il6b_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznb_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (B:) Photosystem II CP47 reaction center protein

SCOPe Domain Sequences for d5zznb_:

Sequence; same for both SEQRES and ATOM records:

>d5zznb_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttrr

Timeline for d5zznb_:

• d5zznb_ first appeared in SCOPe 2.07