SCOPe 2.08: Domain d5zznf_: 5zzn f:

Lineage for d5zznf_ (5zzn f:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries)

8. Domain d5zznf_: 5zzn f: [375268]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
   automated match to d2axtf1
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznf_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5zznf_:

Sequence; same for both SEQRES and ATOM records:

>d5zznf_ f.23.38.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
piftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d5zznf_:

• d5zznf_ first appeared in SCOPe 2.07