SCOPe 2.08: Domain d5zznd_: 5zzn D:

Lineage for d5zznd_ (5zzn D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)

8. Domain d5zznd_: 5zzn D: [375275]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
   automated match to d5h2fd_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznd_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d5zznd_:

Sequence; same for both SEQRES and ATOM records:

>d5zznd_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
fetfytknlllnegirawmapqdqpxenfvfpeevlprgnal

Timeline for d5zznd_:

• d5zznd_ first appeared in SCOPe 2.07