![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (17 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
![]() | Domain d5zznd_: 5zzn D: [375275] Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_ automated match to d5h2fd_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant |
PDB Entry: 5zzn (more details), 2.1 Å
SCOPe Domain Sequences for d5zznd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zznd_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe fetfytknlllnegirawmapqdqpxenfvfpeevlprgnal
Timeline for d5zznd_: