Lineage for d5zznt_ (5zzn T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026547Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 3026548Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 3026589Protein automated matches [375246] (1 species)
    not a true protein
  7. 3026590Species Thermosynechococcus elongatus [TaxId:197221] [375247] (1 PDB entry)
  8. 3026591Domain d5zznt_: 5zzn T: [375248]
    Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
    automated match to d3bz2t_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznt_

PDB Entry: 5zzn (more details), 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5zznt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zznt_ f.23.34.1 (T:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d5zznt_:

Click to download the PDB-style file with coordinates for d5zznt_.
(The format of our PDB-style files is described here.)

Timeline for d5zznt_: