SCOPe 2.08: Domain d5zznt_: 5zzn T:

Lineage for d5zznt_ (5zzn T:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family)
   automatically mapped to Pfam PF01405

5. Family f.23.34.1: PsbT-like [161030] (2 proteins)
   Pfam PF01405

6. Protein automated matches [375246] (1 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [375247] (1 PDB entry)

8. Domain d5zznt_: 5zzn T: [375248]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
   automated match to d3bz2t_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznt_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5zznt_:

Sequence; same for both SEQRES and ATOM records:

>d5zznt_ f.23.34.1 (T:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
metityvfifaciialfffaiffrepprit

Timeline for d5zznt_:

• d5zznt_ first appeared in SCOPe 2.07