SCOPe 2.08: Domain d5zznj_: 5zzn j:

Lineage for d5zznj_ (5zzn j:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)

8. Domain d5zznj_: 5zzn j: [375272]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
   automated match to d5b66j_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznj_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5zznj_:

Sequence; same for both SEQRES and ATOM records:

>d5zznj_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mmseggriplwivatvagmgvivivglffygayaglgssl

Timeline for d5zznj_:

• d5zznj_ first appeared in SCOPe 2.07