PDB entry 5zzn

View 5zzn on RCSB PDB site
Description: Crystal structure of photosystem II from an SQDG-deficient mutant of Thermosynechococcus elongatus
Class: electron transport
Keywords: photosynthesis, electron transport
Deposited on 2018-06-03, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photosystem II protein D1 1
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzna_
  • Chain 'B':
    Compound: Photosystem II CP47 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznb_
  • Chain 'C':
    Compound: Photosystem II CP43 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznc_
  • Chain 'D':
    Compound: Photosystem II D2 protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznd_
  • Chain 'E':
    Compound: Cytochrome b559 subunit alpha
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cytochrome b559 subunit beta
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Photosystem II reaction center protein H
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem II reaction center protein J
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznk_
  • Chain 'L':
    Compound: Photosystem II reaction center protein L
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzno_
  • Chain 'T':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznt_
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Photosystem II reaction center X protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Photosystem II reaction center protein ycf12
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Photosystem II reaction center protein Z
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznz_
  • Chain 'a':
    Compound: Photosystem II protein D1 1
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Photosystem II CP47 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Photosystem II CP43 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Photosystem II D2 protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Cytochrome b559 subunit alpha
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzne_
  • Chain 'f':
    Compound: Cytochrome b559 subunit beta
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznf_
  • Chain 'h':
    Compound: Photosystem II reaction center protein H
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznh_
  • Chain 'i':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem II reaction center protein J
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznj_
  • Chain 'k':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem II reaction center protein L
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznm_
  • Chain 'o':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznu_
  • Chain 'v':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznv_
  • Chain 'x':
    Compound: Photosystem II reaction center X protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zznx_
  • Chain 'y':
    Compound: Photosystem II reaction center protein ycf12
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Photosystem II reaction center protein Z
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OEX, CL, CLA, PHO, BCR, PL9, LMG, UNL, LMT, DMS, CA, LHG, HTG, DGD, GOL, FE2, BCT, HEM, RRX, MG, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznA (A:)
    anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
    llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
    welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
    nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
    ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
    gnvintwadiinranlgmevmhernahnfpldla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznB (B:)
    glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
    vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
    lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
    apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
    iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
    wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
    ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
    rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    idpelspeqvewgfyqkvgdvttrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zznC (C:)
    nsifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipe
    kpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpe
    tleeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrv
    itnptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfg
    warrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtfl
    irdqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldln
    kikndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlafffl
    vghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zznC (C:)
    atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
    eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
    yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
    tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
    afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
    klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
    diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
    whagraraaaagfekgidresepvlsmpsld
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznD (D:)
    ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
    cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
    eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
    wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
    rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
    fetfytknlllnegirawmapqdqpxenfvfpeevlprgnal
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznK (K:)
    klpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznO (O:)
    tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
    efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
    nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
    ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
    epa
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznT (T:)
    metityvfifaciialfffaiffrepprit
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznZ (Z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
    vv
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zzne (e:)
    ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
    plvtdrfeakqqvetfleqlk
    

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >5zznf (f:)
    sypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zznf (f:)
    piftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznh (h:)
    arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
    wka
    

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznj (j:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznm (m:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqk
    

  • Chain 'o':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznu (u:)
    elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
    terqkqilrenlehftvtevetalveggdrynnglyk
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zznv (v:)
    aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
    latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
    vepkilgdkwgggkvyy
    

  • Chain 'x':
    Sequence, based on SEQRES records: (download)
    >5zznx (x:)
    titpslkgffigllsgavvlgltfavliaisqidkvqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zznx (x:)
    titpslkgffigllsgavvlgltfavliaisqidkvqr
    

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.