SCOPe 2.08: Domain d5zznu_: 5zzn u:

Lineage for d5zznu_ (5zzn u:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [158541] (3 PDB entries)
   Uniprot Q9F1L5 37-134

8. Domain d5zznu_: 5zzn u: [375250]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznv_, d5zznx_, d5zznz_
   automated match to d5h2fu_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznu_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5zznu_:

Sequence; same for both SEQRES and ATOM records:

>d5zznu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5zznu_:

• d5zznu_ first appeared in SCOPe 2.07