SCOPe 2.08: Domain d5zznh_: 5zzn h:

Lineage for d5zznh_ (5zzn h:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries)
   Uniprot Q8DJ43 2-65

8. Domain d5zznh_: 5zzn h: [375251]
   Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
   automated match to d5h2fh_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznh_

PDB Entry: 5zzn, 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus

PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5zznh_:

Sequence; same for both SEQRES and ATOM records:

>d5zznh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

Timeline for d5zznh_:

• d5zznh_ first appeared in SCOPe 2.07