| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161054] (3 PDB entries) Uniprot P0A445 10-344 |
| Domain d5zzna_: 5zzn A: [375273] Other proteins in same PDB: d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznk_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_ automated match to d2axta1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant |
PDB Entry: 5zzn (more details), 2.1 Å
SCOPe Domain Sequences for d5zzna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zzna_ f.26.1.1 (A:) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus elongatus [TaxId: 146786]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla
Timeline for d5zzna_: