Lineage for d5zznk_ (5zzn K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026648Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 3026649Species Thermosynechococcus elongatus [TaxId:146786] [161040] (5 PDB entries)
    Uniprot Q9F1K9 10-46
  8. 3026650Domain d5zznk_: 5zzn K: [375265]
    Other proteins in same PDB: d5zzna_, d5zznb_, d5zznc_, d5zznd_, d5zzne_, d5zznf_, d5zznh_, d5zznj_, d5zznm_, d5zzno_, d5zznt_, d5zznu_, d5zznv_, d5zznx_, d5zznz_
    automated match to d5h2fk_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, unl; mutant

Details for d5zznk_

PDB Entry: 5zzn (more details), 2.1 Å

PDB Description: crystal structure of photosystem ii from an sqdg-deficient mutant of thermosynechococcus elongatus
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5zznk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zznk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5zznk_:

Click to download the PDB-style file with coordinates for d5zznk_.
(The format of our PDB-style files is described here.)

Timeline for d5zznk_: