Lineage for d6j71a2 (6j71 A:188-344)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3031041Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 3031042Protein automated matches [232407] (3 species)
    not a true protein
  7. 3031043Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 3031077Domain d6j71a2: 6j71 A:188-344 [365401]
    Other proteins in same PDB: d6j71a1, d6j71a3, d6j71b1, d6j71b2
    automated match to d1n8zc3
    complexed with bma

Details for d6j71a2

PDB Entry: 6j71 (more details), 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d6j71a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j71a2 g.3.9.0 (A:188-344) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

SCOPe Domain Coordinates for d6j71a2:

Click to download the PDB-style file with coordinates for d6j71a2.
(The format of our PDB-style files is described here.)

Timeline for d6j71a2: