SCOPe 2.08: Domain d6j71a4: 6j71 A:511-639

Lineage for d6j71a4 (6j71 A:511-639)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)

8. Domain d6j71a4: 6j71 A:511-639 [365403]
   Other proteins in same PDB: d6j71a1, d6j71a3, d6j71b1, d6j71b2
   automated match to d1n8zc4
   complexed with bma

Details for d6j71a4

PDB Entry: 6j71, 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d6j71a4:

Sequence; same for both SEQRES and ATOM records:

>d6j71a4 g.3.9.0 (A:511-639) automated matches {Human (Homo sapiens) [TaxId: 9606]}
chqlcarghcwgpgptqcvncsqflrgqecveecrvlqglpreyvnarhclpchpecqpq
ngsvtcfgpeadqcvacahykdppfcvarcpsgvkpdlsympiwkfpdeegacqpcpinc
thscvdldd

Timeline for d6j71a4:

• d6j71a4 first appeared in SCOPe 2.07