PDB entry 6j71

View 6j71 on RCSB PDB site
Description: HuA21-scFv in complex with the extracellular domain(ECD) of HER2
Class: signaling protein
Keywords: Tyrosine-protein kinase, antibody, Transcription regulation, SIGNALING PROTEIN
Deposited on 2019-01-16, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor tyrosine-protein kinase erbB-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB2, HER2, MLN19, NEU, NGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j71a1, d6j71a2, d6j71a3, d6j71a4
  • Chain 'B':
    Compound: anti-HER2 humanized antibody HuA21
    Species: Murine adenovirus 1 [TaxId:10530]
    Database cross-references and differences (RAF-indexed):
    • PDB 6J71 (0-253)
    Domains in SCOPe 2.07: d6j71b1, d6j71b2
  • Heterogens: BMA, NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6j71A (A:)
    stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
    gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
    lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtnrsrachpcspmckg
    srcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgpkhsdclaclhfnhs
    gicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstdvgsctlvcplhnqe
    vtaedgtqrcekcskpcarvcyglgmehlrevravtsaniqefagckkifgslaflpesf
    dgdpasntaplqpeqlqvfetleeitgylyisawpdslpdlsvfqnlqvirgrilhngay
    sltlqglgiswlglrslrelgsglalihhnthlcfvhtvpwdqlfrnphqallhtanrpe
    decvgeglachqlcarghcwgpgptqcvncsqflrgqecveecrvlqglpreyvnarhcl
    pchpecqpqngsvtcfgpeadqcvacahykdppfcvarcpsgvkpdlsympiwkfpdeeg
    acqpcpincthscvdldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j71B (B:)
    adivltqspdslavslgervtinckssqpleysnnqwnylawyqqkpgqspklliswast
    rksgvpdrfsgsgsgtdftltissvqaedvavyycgqysdypntfgagtkleikrggggs
    ggggsggggsggggsqvqlvqsgaevvkpgasvkisckasgypftqyfihwvkqnpgqrl
    ewigqisssyatvdynqkfkgkatltvdtsasiaymelsslrsedtavyycvrsgnyeey
    amdywgqgtlvtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j71B (B:)
    adivltqspdslavslgervtinckssqpleysnnqwnylawyqqkpgqspklliswast
    rksgvpdrfsgsgsgtdftltissvqaedvavyycgqysdypntfgagtkleikqvqlvq
    sgaevvkpgasvkisckasgypftqyfihwvkqnpgqrlewigqisssyatvdynqkfkg
    katltvdtsasiaymelsslrsedtavyycvrsgnyeeyamdywgqgtlvtvs