SCOPe 2.08: Domain d6j71b2: 6j71 B:140-258

Lineage for d6j71b2 (6j71 B:140-258)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Murine adenovirus 1 [TaxId:10530] [365412] (1 PDB entry)

8. Domain d6j71b2: 6j71 B:140-258 [365414]
   Other proteins in same PDB: d6j71a1, d6j71a2, d6j71a3, d6j71a4
   automated match to d6ehya1
   complexed with bma

Details for d6j71b2

PDB Entry: 6j71, 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2

PDB Compounds: (B:) anti-HER2 humanized antibody HuA21

SCOPe Domain Sequences for d6j71b2:

Sequence; same for both SEQRES and ATOM records:

>d6j71b2 b.1.1.0 (B:140-258) automated matches {Murine adenovirus 1 [TaxId: 10530]}
qvqlvqsgaevvkpgasvkisckasgypftqyfihwvkqnpgqrlewigqisssyatvdy
nqkfkgkatltvdtsasiaymelsslrsedtavyycvrsgnyeeyamdywgqgtlvtvs

Timeline for d6j71b2:

• d6j71b2 first appeared in SCOPe 2.07