Lineage for d6j71b2 (6j71 B:140-258)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 3065350Species Murine adenovirus 1 [TaxId:10530] [365412] (1 PDB entry)
  8. 3065352Domain d6j71b2: 6j71 B:140-258 [365414]
    Other proteins in same PDB: d6j71a1, d6j71a2, d6j71a3, d6j71a4
    automated match to d6ehya1
    complexed with bma, nag

Details for d6j71b2

PDB Entry: 6j71 (more details), 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2
PDB Compounds: (B:) anti-HER2 humanized antibody HuA21

SCOPe Domain Sequences for d6j71b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j71b2 b.1.1.0 (B:140-258) automated matches {Murine adenovirus 1 [TaxId: 10530]}
qvqlvqsgaevvkpgasvkisckasgypftqyfihwvkqnpgqrlewigqisssyatvdy
nqkfkgkatltvdtsasiaymelsslrsedtavyycvrsgnyeeyamdywgqgtlvtvs

SCOPe Domain Coordinates for d6j71b2:

Click to download the PDB-style file with coordinates for d6j71b2.
(The format of our PDB-style files is described here.)

Timeline for d6j71b2:

  • d6j71b2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28