Lineage for d6j71b1 (6j71 B:5-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761331Species Murine adenovirus 1 [TaxId:10530] [365412] (1 PDB entry)
  8. 2761332Domain d6j71b1: 6j71 B:5-118 [365413]
    Other proteins in same PDB: d6j71a1, d6j71a2, d6j71a3, d6j71a4
    automated match to d6ehya2
    complexed with bma

Details for d6j71b1

PDB Entry: 6j71 (more details), 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2
PDB Compounds: (B:) anti-HER2 humanized antibody HuA21

SCOPe Domain Sequences for d6j71b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j71b1 b.1.1.0 (B:5-118) automated matches {Murine adenovirus 1 [TaxId: 10530]}
adivltqspdslavslgervtinckssqpleysnnqwnylawyqqkpgqspklliswast
rksgvpdrfsgsgsgtdftltissvqaedvavyycgqysdypntfgagtkleik

SCOPe Domain Coordinates for d6j71b1:

Click to download the PDB-style file with coordinates for d6j71b1.
(The format of our PDB-style files is described here.)

Timeline for d6j71b1: