SCOPe 2.08: Domain d6j71a1: 6j71 A:22-187

Lineage for d6j71a1 (6j71 A:22-187)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d6j71a1: 6j71 A:22-187 [365400]
   Other proteins in same PDB: d6j71a2, d6j71a4, d6j71b1, d6j71b2
   automated match to d1n8zc1
   complexed with bma

Details for d6j71a1

PDB Entry: 6j71, 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d6j71a1:

Sequence; same for both SEQRES and ATOM records:

>d6j71a1 c.10.2.0 (A:22-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Timeline for d6j71a1:

• d6j71a1 first appeared in SCOPe 2.07