Lineage for d6j71a1 (6j71 A:22-187)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435351Species Human (Homo sapiens) [TaxId:9606] [188042] (18 PDB entries)
  8. 3065338Domain d6j71a1: 6j71 A:22-187 [365400]
    Other proteins in same PDB: d6j71a2, d6j71a4, d6j71b1, d6j71b2
    automated match to d1n8zc1
    complexed with bma, nag

Details for d6j71a1

PDB Entry: 6j71 (more details), 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d6j71a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j71a1 c.10.2.0 (A:22-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

SCOPe Domain Coordinates for d6j71a1:

Click to download the PDB-style file with coordinates for d6j71a1.
(The format of our PDB-style files is described here.)

Timeline for d6j71a1:

  • d6j71a1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28