Lineage for d6j71a3 (6j71 A:345-510)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851937Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)
  8. 2851969Domain d6j71a3: 6j71 A:345-510 [365402]
    Other proteins in same PDB: d6j71a2, d6j71a4, d6j71b1, d6j71b2
    automated match to d1n8zc2
    complexed with bma

Details for d6j71a3

PDB Entry: 6j71 (more details), 2.92 Å

PDB Description: hua21-scfv in complex with the extracellular domain(ecd) of her2
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d6j71a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j71a3 c.10.2.0 (A:345-510) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetle
eitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsg
lalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla

SCOPe Domain Coordinates for d6j71a3:

Click to download the PDB-style file with coordinates for d6j71a3.
(The format of our PDB-style files is described here.)

Timeline for d6j71a3: