| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
| Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
| Protein Protooncoprotein Her2 extracellular domain [82889] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries) |
| Domain d1n8zc3: 1n8z C:166-322 [80324] Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc1, d1n8zc2 complexed with nag, so4 |
PDB Entry: 1n8z (more details), 2.52 Å
SCOPe Domain Sequences for d1n8zc3:
Sequence, based on SEQRES records: (download)
>d1n8zc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg
>d1n8zc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtatqrcekcskpcarvcyg
Timeline for d1n8zc3:
View in 3DDomains from other chains: (mouse over for more information) d1n8za1, d1n8za2, d1n8zb1, d1n8zb2 |