![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
![]() | Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
![]() | Protein automated matches [232407] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries) |
![]() | Domain d5u8ra2: 5u8r A:150-301 [347742] Other proteins in same PDB: d5u8ra1, d5u8ra3, d5u8ra4, d5u8ra5, d5u8rh_, d5u8rl_ automated match to d2dtge6 complexed with imd, mlt, nag, so4 |
PDB Entry: 5u8r (more details), 3 Å
SCOPe Domain Sequences for d5u8ra2:
Sequence, based on SEQRES records: (download)
>d5u8ra2 g.3.9.0 (A:150-301) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlcpgtmeekpmcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgsc sapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvih dgecmqecpsgfirngsqsmycipcegpcpkv
>d5u8ra2 g.3.9.0 (A:150-301) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlcpgcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgscsapdndt acvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvihdgecmqe cpsgfirngsqsmycipcegpcpkv
Timeline for d5u8ra2:
![]() Domains from same chain: (mouse over for more information) d5u8ra1, d5u8ra3, d5u8ra4, d5u8ra5 |