SCOPe 2.07: Domain d5u8ra2: 5u8r A:150-301

Lineage for d5u8ra2 (5u8r A:150-301)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232408] (16 PDB entries)

8. Domain d5u8ra2: 5u8r A:150-301 [347742]
   Other proteins in same PDB: d5u8ra1, d5u8ra3, d5u8ra4, d5u8ra5, d5u8rh_, d5u8rl_
   automated match to d2dtge6
   complexed with imd, mlt, nag, so4

Details for d5u8ra2

PDB Entry: 5u8r, 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor

PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d5u8ra2:

Sequence, based on SEQRES records:

>d5u8ra2 g.3.9.0 (A:150-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlcpgtmeekpmcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgsc
sapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvih
dgecmqecpsgfirngsqsmycipcegpcpkv

Sequence, based on observed residues (ATOM records):

>d5u8ra2 g.3.9.0 (A:150-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlcpgcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgscsapdndt
acvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvihdgecmqe
cpsgfirngsqsmycipcegpcpkv

Timeline for d5u8ra2:

• d5u8ra2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06