Lineage for d5u8ra2 (5u8r A:150-301)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582446Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2582517Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 2582518Protein automated matches [232407] (3 species)
    not a true protein
  7. 2582519Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 3047680Domain d5u8ra2: 5u8r A:150-301 [347742]
    Other proteins in same PDB: d5u8ra1, d5u8ra3, d5u8ra4, d5u8ra5, d5u8rh_, d5u8rl_
    automated match to d2dtge6
    complexed with imd, mlt, nag, so4

Details for d5u8ra2

PDB Entry: 5u8r (more details), 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d5u8ra2:

Sequence, based on SEQRES records: (download)

>d5u8ra2 g.3.9.0 (A:150-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlcpgtmeekpmcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgsc
sapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvih
dgecmqecpsgfirngsqsmycipcegpcpkv

Sequence, based on observed residues (ATOM records): (download)

>d5u8ra2 g.3.9.0 (A:150-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlcpgcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgscsapdndt
acvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvihdgecmqe
cpsgfirngsqsmycipcegpcpkv

SCOPe Domain Coordinates for d5u8ra2:

Click to download the PDB-style file with coordinates for d5u8ra2.
(The format of our PDB-style files is described here.)

Timeline for d5u8ra2:

  • d5u8ra2 is new in SCOPe 2.07-stable