PDB entry 5u8r

View 5u8r on RCSB PDB site
Description: Structure of the ectodomain of the human Type 1 insulin-like growth factor receptor
Class: transferase/immune system
Keywords: Receptor, tyrosine kinase, Type 1 insulin-like, growth factor receptor, TRANSFERASE-IMMUNE SYSTEM complex
Deposited on 2016-12-14, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u8ra1, d5u8ra2, d5u8ra3, d5u8ra4, d5u8ra5
  • Chain 'H':
    Compound: Fv 24-60 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5U8R
    Domains in SCOPe 2.07: d5u8rh_
  • Chain 'L':
    Compound: Fv 24-60 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5U8R (0-107)
    Domains in SCOPe 2.07: d5u8rl_
  • Heterogens: SO4, MLT, NAG, IMD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u8rA (A:)
    eicgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrv
    agleslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlc
    ylstvdwslildavsnnyivgnkppkecgdlcpgtmeekpmcekttinneynyrcwttnr
    cqkmcpstcgkractennecchpeclgscsapdndtacvacrhyyyagvcvpacppntyr
    fegwrcvdrdfcanilsaessdsegfvihdgecmqecpsgfirngsqsmycipcegpcpk
    vceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvki
    rhshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfaf
    npklcvseiyrmeevtgtkgrqskgdintrnngerascesdvlhftstttsknriiitwh
    ryrppdyrdlisftvyykeapfknvteydgqdacgsnswnmvdvdlppnkdvepgillhg
    lkpwtqyavyvkavtltmvendhirgakseilyirtnasvpsipldvlsasnsssqlivk
    wnppslpngnlsyyivrwqrqpqdgylyrhnycskdkipirkyadgtidieevtenpkte
    vcggekgpccacpkteaekqaekeeaeyrkvfenflhnsifvprperkrrdvmqvanagn
    neteypffesrvdnkertvisnlrpftlyridihscnheaeklgcsasnfvfartmpaeg
    addipgpvtweprpensiflkwpepenpnglilmyeikygsqvedqrecvsrqeyrkygg
    aklnrlnpgnytariqatslsgngswtdpvffyvqaktgyenfih
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8rA (A:)
    eicgpgidirndyqqlkrlenctviegylhilliskarsyrfpkltviteylllfrvagl
    eslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlcyls
    tvdwslildavsnnyivgnkppkecgdlcpgcekttinneynyrcwttnrcqkmcpstcg
    kractennecchpeclgscsapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrd
    fcanilsaessdsegfvihdgecmqecpsgfirngsqsmycipcegpcpkvceeekktkt
    idsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvkirhshalvsls
    flknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfafnpklcvseiy
    rmeevtgtkgrqskgdintrnngerascesdvlhftstttsknriiitwhryrppdyrdl
    isftvyykeapfknvteynswnmvdvdlppnkdvepgillhglkpwtqyavyvkavtltm
    vendhirgakseilyirtnasvpsipldvlsasnsssqlivkwnppslpngnlsyyivrw
    qrqpqdgylyrhnycskdkipirkekeeaeyrkvfenflhnsifvpreypffesrvdnke
    rtvisnlrpftlyridihscnheaeklgcsasnfvfartmpaegaddipgpvtweprpen
    siflkwpepenpnglilmyeikygsqvedqrecvsrqeyrkyggaklnrlnpgnytariq
    atslsgngswtdpvffyvqak
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5u8rH (H:)
    gtqvqlqqsgpdvvrpgvsvkisckgsgytftdyaihwvkqshakslewigvistyngnt
    kynqkfkgkaaitvdkssstaylelarltsedsaiyycasygdlyvmdywgqgtsvtvss
    enlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8rH (H:)
    tqvqlqqsgpdvvrpgvsvkisckgsgytftdyaihwvkqshakslewigvistyngntk
    ynqkfkgkaaitvdkssstaylelarltsedsaiyycasygdlyvmdywgqgtsvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u8rL (L:)
    gdivltqspatlsvtpgdsvslscrasqtisnnlhwyqqkshesprllikyasqsisgip
    srfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgagtklelk