Lineage for d5u8rh_ (5u8r H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (28 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (776 PDB entries)
  8. 3047696Domain d5u8rh_: 5u8r H: [347758]
    Other proteins in same PDB: d5u8ra1, d5u8ra2, d5u8ra3, d5u8ra4, d5u8ra5, d5u8rl_
    automated match to d2p49b_
    complexed with imd, mlt, nag, so4

Details for d5u8rh_

PDB Entry: 5u8r (more details), 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor
PDB Compounds: (H:) Fv 24-60 heavy chain

SCOPe Domain Sequences for d5u8rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8rh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqvqlqqsgpdvvrpgvsvkisckgsgytftdyaihwvkqshakslewigvistyngntk
ynqkfkgkaaitvdkssstaylelarltsedsaiyycasygdlyvmdywgqgtsvtvs

SCOPe Domain Coordinates for d5u8rh_:

Click to download the PDB-style file with coordinates for d5u8rh_.
(The format of our PDB-style files is described here.)

Timeline for d5u8rh_:

  • d5u8rh_ is new in SCOPe 2.07-stable