Lineage for d5u8ra5 (5u8r A:798-897)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762355Domain d5u8ra5: 5u8r A:798-897 [347745]
    Other proteins in same PDB: d5u8ra1, d5u8ra2, d5u8ra3, d5u8rh_, d5u8rl_
    automated match to d2dtge1
    complexed with imd, mlt, nag, so4

Details for d5u8ra5

PDB Entry: 5u8r (more details), 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d5u8ra5:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8ra5 b.1.2.0 (A:798-897) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aegaddipgpvtweprpensiflkwpepenpnglilmyeikygsqvedqrecvsrqeyrk
yggaklnrlnpgnytariqatslsgngswtdpvffyvqak

SCOPe Domain Coordinates for d5u8ra5:

Click to download the PDB-style file with coordinates for d5u8ra5.
(The format of our PDB-style files is described here.)

Timeline for d5u8ra5: