SCOPe 2.08: Domain d5u8ra1: 5u8r A:1-149

Lineage for d5u8ra1 (5u8r A:1-149)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d5u8ra1: 5u8r A:1-149 [347741]
   Other proteins in same PDB: d5u8ra2, d5u8ra4, d5u8ra5, d5u8rh_, d5u8rl_
   automated match to d2dtge4
   complexed with imd, mlt, nag, so4

Details for d5u8ra1

PDB Entry: 5u8r, 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor

PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d5u8ra1:

Sequence, based on SEQRES records:

>d5u8ra1 c.10.2.0 (A:1-149) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eicgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrv
agleslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlc
ylstvdwslildavsnnyivgnkppkecg

Sequence, based on observed residues (ATOM records):

>d5u8ra1 c.10.2.0 (A:1-149) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eicgpgidirndyqqlkrlenctviegylhilliskarsyrfpkltviteylllfrvagl
eslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlcyls
tvdwslildavsnnyivgnkppkecg

Timeline for d5u8ra1:

• d5u8ra1 first appeared in SCOPe 2.07