![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
![]() | Domain d5u8ra4: 5u8r A:458-578 [347744] Other proteins in same PDB: d5u8ra1, d5u8ra2, d5u8ra3, d5u8rh_, d5u8rl_ automated match to d2dtge3 complexed with imd, mlt, nag, so4 |
PDB Entry: 5u8r (more details), 3 Å
SCOPe Domain Sequences for d5u8ra4:
Sequence, based on SEQRES records: (download)
>d5u8ra4 b.1.2.0 (A:458-578) automated matches {Human (Homo sapiens) [TaxId: 9606]} cesdvlhftstttsknriiitwhryrppdyrdlisftvyykeapfknvteydgqdacgsn swnmvdvdlppnkdvepgillhglkpwtqyavyvkavtltmvendhirgakseilyirtn a
>d5u8ra4 b.1.2.0 (A:458-578) automated matches {Human (Homo sapiens) [TaxId: 9606]} cesdvlhftstttsknriiitwhryrppdyrdlisftvyykeapfknvteynswnmvdvd lppnkdvepgillhglkpwtqyavyvkavtltmvendhirgakseilyirtna
Timeline for d5u8ra4:
![]() Domains from same chain: (mouse over for more information) d5u8ra1, d5u8ra2, d5u8ra3, d5u8ra5 |