Lineage for d5u8rl_ (5u8r L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745042Domain d5u8rl_: 5u8r L: [347785]
    Other proteins in same PDB: d5u8ra1, d5u8ra2, d5u8ra3, d5u8ra4, d5u8ra5, d5u8rh_
    automated match to d1uacl_
    complexed with imd, mlt, nag, so4

Details for d5u8rl_

PDB Entry: 5u8r (more details), 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor
PDB Compounds: (L:) Fv 24-60 light chain

SCOPe Domain Sequences for d5u8rl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8rl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdivltqspatlsvtpgdsvslscrasqtisnnlhwyqqkshesprllikyasqsisgip
srfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgagtklelk

SCOPe Domain Coordinates for d5u8rl_:

Click to download the PDB-style file with coordinates for d5u8rl_.
(The format of our PDB-style files is described here.)

Timeline for d5u8rl_: