Lineage for d5u8ra3 (5u8r A:302-457)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851937Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)
  8. 2851964Domain d5u8ra3: 5u8r A:302-457 [347743]
    Other proteins in same PDB: d5u8ra2, d5u8ra4, d5u8ra5, d5u8rh_, d5u8rl_
    automated match to d2dtge5
    complexed with imd, mlt, nag, so4

Details for d5u8ra3

PDB Entry: 5u8r (more details), 3 Å

PDB Description: structure of the ectodomain of the human type 1 insulin-like growth factor receptor
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d5u8ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8ra3 c.10.2.0 (A:302-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvkir
hshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfafn
pklcvseiyrmeevtgtkgrqskgdintrnngeras

SCOPe Domain Coordinates for d5u8ra3:

Click to download the PDB-style file with coordinates for d5u8ra3.
(The format of our PDB-style files is described here.)

Timeline for d5u8ra3: