Lineage for d1hnwq_ (1hnw Q:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins) 
Protein Ribosomal protein S17 [50304] (2 species) Species Thermus thermophilus [TaxId:274] [50305] (6 PDB entries) 
Domain d1hnwq_: 1hnw Q: [25355]
Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
Details for d1hnwq_
PDB Entry: 1hnw (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
SCOP Domain Sequences for d1hnwq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
SCOP Domain Coordinates for d1hnwq_:
Click to download the PDB-style file with coordinates for d1hnwq_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnwq_:
- d1hnwq_ appears in SCOP 1.57
- d1hnwq_ appears in the current release, SCOPe 2.08
View in 3D
