SCOP 1.55: Domain d1hnwc1: 1hnw C:2-106

Lineage for d1hnwc1 (1hnw C:2-106)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family)

5. Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (6 PDB entries)

8. Domain d1hnwc1: 1hnw C:2-106 [38834]
   Other proteins in same PDB: d1hnwb_, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwc1

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwc1:

Sequence; same for both SEQRES and ATOM records:

>d1hnwc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1hnwc1:

• d1hnwc1 appears in SCOP 1.57
  
• d1hnwc1 appears in the current release, SCOPe 2.08