Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (2 species) |
Species Thermus thermophilus [TaxId:274] [56051] (7 PDB entries) |
Domain d1hnwh_: 1hnw H: [41471] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d1hnwh_: